PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00179.1_g00065.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 356aa    MW: 40382 Da    PI: 8.9326
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00179.1_g00065.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.36.4e-1424951288
                             HTT-EE--HHH.HTT...---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                       B3 12 ksgrlvlpkkfaeeh...ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88
                              s  +++p  f ++h   +   + + +++l++  s  +Wevk+  ++++    lt+GW++F+  +  ++gD+v+F++dg+ 
  Rsa1.0_00179.1_g00065.1 24 HS-HISIPIAFYSKHmtnE--DNVNAMVKLRSdASDLTWEVKM--DGRR----LTQGWQKFATKHAFRVGDIVIFRHDGDL 95
                             44.49**********8642..234557888876888*******..9998....***********************88753 PP

2B359.65.6e-19141231597
                              -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                       B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                               +++++l+++ l+lp +f +++g+ ++e  +++l +e+g+ W++ l+y  +sg+++++ GW++F+ +n+ +++D+++Fkl++ ++ 
  Rsa1.0_00179.1_g00065.1 141 RVTESNLSKDALYLPLHFSRSNGLMNRE-CEIILLNEDGKPWTLFLKYYETSGQVYIRYGWRSFCVQNRKRANDVLTFKLMK-TGS 224
                              57899999**************877544.59*************************************************98.555 PP

                              ..EEEEE CS
                       B3  91 elvvkvf 97 
                              ++v++++
  Rsa1.0_00179.1_g00065.1 225 KPVLQLR 231
                              5777765 PP

3B341.42.6e-13256342188
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f++ +++ ++ ks+ l+lp +f+ ++g+k+++  +++l d+ g + +  l+ + k gr+ l+kG  +F++ang+k+g+++ ++l++
  Rsa1.0_00179.1_g00065.1 256 FVTLTLKQYHIKSCKLCLPVPFVMANGIKNAR--EIILVDRYGVRRTTSLKPDDKFGRMRLGKGCIKFCEANGVKAGESIRLELIK 339
                              67778899******************999655..8********999999988999999*************************996 PP

                              S.S CS
                       B3  87 r.s 88 
                              + +
  Rsa1.0_00179.1_g00065.1 340 EeE 342
                              633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.0E-206107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-198107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.46212105IPR003340B3 DNA binding domain
CDDcd100174.91E-1313102No hitNo description
SMARTSM010198.4E-1815105IPR003340B3 DNA binding domain
PfamPF023627.0E-92494IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-19130233IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-21133236IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.24137233IPR003340B3 DNA binding domain
CDDcd100176.17E-22137231No hitNo description
SMARTSM010191.7E-22137234IPR003340B3 DNA binding domain
PfamPF023626.4E-18141231IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.6E-15250354IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.82E-14254352IPR015300DNA-binding pseudobarrel domain
CDDcd100172.33E-14255341No hitNo description
PROSITE profilePS508638.854256355IPR003340B3 DNA binding domain
PfamPF023621.6E-11256343IPR003340B3 DNA binding domain
SMARTSM010194.4E-16256356IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MAANGSASSP NNPHFLQPLL PGFHSHISIP IAFYSKHMTN EDNVNAMVKL RSDASDLTWE  60
VKMDGRRLTQ GWQKFATKHA FRVGDIVIFR HDGDLLFHVT PFGPSCCEIQ YNDDDDDEKY  120
HQQQAREAGS SSSDQSCLVA RVTESNLSKD ALYLPLHFSR SNGLMNRECE IILLNEDGKP  180
WTLFLKYYET SGQVYIRYGW RSFCVQNRKR ANDVLTFKLM KTGSKPVLQL RASVYNRPSS  240
SSSSSSSSSS ISQDRFVTLT LKQYHIKSCK LCLPVPFVMA NGIKNAREII LVDRYGVRRT  300
TSLKPDDKFG RMRLGKGCIK FCEANGVKAG ESIRLELIKE EEDDKENHLL KFCSKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894315e-82AC189431.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068B07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013624170.10.0PREDICTED: B3 domain-containing protein REM7-like
TrEMBLA0A078JJX00.0A0A078JJX0_BRANA; BnaC03g73290D protein
STRINGBra029892.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.15e-83B3 family protein